SCOPe 2.05: Domain d2w8bh_: 2w8b H:

Lineage for d2w8bh_ (2w8b H:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.1: OmpA-like [103089] (3 proteins)
   Pfam PF00691

6. Protein automated matches [190318] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187135] (2 PDB entries)

8. Domain d2w8bh_: 2w8b H: [169109]
   Other proteins in same PDB: d2w8ba1, d2w8ba2, d2w8bb1, d2w8bb2, d2w8bd1, d2w8bd2, d2w8bf1, d2w8bf2
   automated match to d1oapa_
   complexed with act, gol, so4

Details for d2w8bh_

PDB Entry: 2w8b, 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal

PDB Compounds: (H:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d2w8bh_:

Sequence; same for both SEQRES and ATOM records:

>d2w8bh_ d.79.7.1 (H:) automated matches {Escherichia coli [TaxId: 562]}
qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra
navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvyl

Timeline for d2w8bh_:

• d2w8bh_ first appeared in SCOPe 2.01
  
• d2w8bh_ appears in SCOPe 2.04
  
• d2w8bh_ is called d2w8bh1 in SCOPe 2.06
  
• d2w8bh_ appears in the current release, SCOPe 2.08, called d2w8bh1