Lineage for d2w8bh_ (2w8b H:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032694Superfamily d.79.7: OmpA-like [103088] (1 family) (S)
  5. 1032695Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 1032704Protein automated matches [190318] (1 species)
    not a true protein
  7. 1032705Species Escherichia coli [TaxId:562] [187135] (2 PDB entries)
  8. 1032713Domain d2w8bh_: 2w8b H: [169109]
    automated match to d1oapa_
    complexed with act, gol, so4

Details for d2w8bh_

PDB Entry: 2w8b (more details), 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal
PDB Compounds: (H:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d2w8bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8bh_ d.79.7.1 (H:) automated matches {Escherichia coli [TaxId: 562]}
qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra
navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvyl

SCOPe Domain Coordinates for d2w8bh_:

Click to download the PDB-style file with coordinates for d2w8bh_.
(The format of our PDB-style files is described here.)

Timeline for d2w8bh_: