Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) |
Family d.79.7.1: OmpA-like [103089] (3 proteins) Pfam PF00691 |
Protein automated matches [190318] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [187135] (2 PDB entries) |
Domain d2w8bg1: 2w8b G:67-173 [169108] Other proteins in same PDB: d2w8ba1, d2w8ba2, d2w8bb1, d2w8bb2, d2w8bd1, d2w8bd2, d2w8be2, d2w8bf1, d2w8bf2, d2w8bg2, d2w8bh2 automated match to d1oapa_ complexed with act, gol, so4 |
PDB Entry: 2w8b (more details), 1.86 Å
SCOPe Domain Sequences for d2w8bg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w8bg1 d.79.7.1 (G:67-173) automated matches {Escherichia coli [TaxId: 562]} qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy
Timeline for d2w8bg1: