Lineage for d2w8bc_ (2w8b C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658417Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 1658418Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 1658427Protein automated matches [190318] (2 species)
    not a true protein
  7. 1658428Species Escherichia coli [TaxId:562] [187135] (2 PDB entries)
  8. 1658433Domain d2w8bc_: 2w8b C: [169106]
    Other proteins in same PDB: d2w8ba1, d2w8ba2, d2w8bb1, d2w8bb2, d2w8bd1, d2w8bd2, d2w8bf1, d2w8bf2
    automated match to d1oapa_
    complexed with act, gol, so4

Details for d2w8bc_

PDB Entry: 2w8b (more details), 1.86 Å

PDB Description: crystal structure of processed tolb in complex with pal
PDB Compounds: (C:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d2w8bc_:

Sequence, based on SEQRES records: (download)

>d2w8bc_ d.79.7.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
nnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerran
avkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

Sequence, based on observed residues (ATOM records): (download)

>d2w8bc_ d.79.7.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
nnivyfdldkydirsdfaqmldahanflrssykvtveghadergtpeynislgerranav
kmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy

SCOPe Domain Coordinates for d2w8bc_:

Click to download the PDB-style file with coordinates for d2w8bc_.
(The format of our PDB-style files is described here.)

Timeline for d2w8bc_: