| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
| Family d.79.7.1: OmpA-like [103089] (3 proteins) Pfam PF00691 |
| Protein automated matches [190318] (2 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187135] (2 PDB entries) |
| Domain d2w8bc_: 2w8b C: [169106] Other proteins in same PDB: d2w8ba1, d2w8ba2, d2w8bb1, d2w8bb2, d2w8bd1, d2w8bd2, d2w8bf1, d2w8bf2 automated match to d1oapa_ complexed with act, gol, so4 |
PDB Entry: 2w8b (more details), 1.86 Å
SCOPe Domain Sequences for d2w8bc_:
Sequence, based on SEQRES records: (download)
>d2w8bc_ d.79.7.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
nnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerran
avkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy
>d2w8bc_ d.79.7.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
nnivyfdldkydirsdfaqmldahanflrssykvtveghadergtpeynislgerranav
kmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy
Timeline for d2w8bc_: