Lineage for d2w7ia_ (2w7i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896255Protein Serine hydroxymethyltransferase [53429] (7 species)
  7. 2896256Species Bacillus stearothermophilus [TaxId:1422] [75272] (39 PDB entries)
  8. 2896293Domain d2w7ia_: 2w7i A: [169098]
    automated match to d1kkja_
    complexed with plp

Details for d2w7ia_

PDB Entry: 2w7i (more details), 2.72 Å

PDB Description: crystal structure of y61absshmt internal aldimine
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d2w7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w7ia_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
aggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd

SCOPe Domain Coordinates for d2w7ia_:

Click to download the PDB-style file with coordinates for d2w7ia_.
(The format of our PDB-style files is described here.)

Timeline for d2w7ia_: