Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein Serine hydroxymethyltransferase [53429] (6 species) |
Species Bacillus stearothermophilus [TaxId:1422] [75272] (39 PDB entries) |
Domain d2w7fa_: 2w7f A: [169095] automated match to d1kkja_ complexed with mpd, plp, po4, ser |
PDB Entry: 2w7f (more details), 1.67 Å
SCOPe Domain Sequences for d2w7fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w7fa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkfaegypgrry yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd
Timeline for d2w7fa_: