SCOPe 2.05: Domain d2w79b_: 2w79 B:

Lineage for d2w79b_ (2w79 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein automated matches [190186] (9 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [186925] (4 PDB entries)

8. Domain d2w79b_: 2w79 B: [169092]
   automated match to d1qo2a_
   complexed with cl

Details for d2w79b_

PDB Entry: 2w79, 1.85 Å

PDB Description: establishing wild-type levels of catalytic activity on natural and artificial (ba)8-barrel protein scaffolds

PDB Compounds: (B:) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d2w79b_:

Sequence, based on SEQRES records:

>d2w79b_ c.1.2.1 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
mlvvpaidlfrgkvarmikgrkentifyekdpvelveklieegftlihvvdlsnaiensg
enlpvleklsefaeyiqigggirsldyaeklrklgyrrqivsskvledpsslkslreidv
epvfslvtrggrvafkgwlaeeeidpvsllkrlkeygleeivhteiekvgtlqehdfslt
kkiaieaevkvlaaggissenslktaqkvhtetngllkgvivgraflegiltvevmkrya
r

Sequence, based on observed residues (ATOM records):

>d2w79b_ c.1.2.1 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
mlvvpaidlfrgkvarmikgrkentifyekdpvelveklieegftlihvvdlsnaiensg
enlpvleklsefaeyiqigggirsldyaeklrklgyrrqivsskvledpsslkslreidv
epvfslvtrggrvafkgwlaeidpvsllkrlkeygleeivhteiekvgtlqehdfsltkk
iaieaevkvlaaggissenslktaqkvhtetngllkgvivgraflegiltvevmkryar

Timeline for d2w79b_:

• d2w79b_ first appeared in SCOPe 2.01
  
• d2w79b_ appears in SCOPe 2.04
  
• d2w79b_ appears in SCOPe 2.06
  
• d2w79b_ appears in the current release, SCOPe 2.08