Lineage for d2w72d_ (2w72 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300599Species Human (Homo sapiens) [TaxId:9606] [46501] (284 PDB entries)
    Uniprot P68871
  8. 2300601Domain d2w72d_: 2w72 D: [169086]
    Other proteins in same PDB: d2w72a_, d2w72c_
    automated match to d1j7wb_
    complexed with hem, k, po4, so4, xe; mutant

Details for d2w72d_

PDB Entry: 2w72 (more details), 1.07 Å

PDB Description: deoxygenated structure of a distal site hemoglobin mutant plus xe
PDB Compounds: (D:) human hemoglobin a

SCOPe Domain Sequences for d2w72d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w72d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d2w72d_:

Click to download the PDB-style file with coordinates for d2w72d_.
(The format of our PDB-style files is described here.)

Timeline for d2w72d_: