Lineage for d2w72c_ (2w72 C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1076761Protein automated matches [190359] (36 species)
    not a true protein
  7. 1076927Species Human (Homo sapiens) [TaxId:9606] [188371] (3 PDB entries)
  8. 1076928Domain d2w72c_: 2w72 C: [169085]
    Other proteins in same PDB: d2w72b_, d2w72d_
    automated match to d1j7sa_
    complexed with hem, k, po4, so4, xe; mutant

Details for d2w72c_

PDB Entry: 2w72 (more details), 1.07 Å

PDB Description: deoxygenated structure of a distal site hemoglobin mutant plus xe
PDB Compounds: (C:) human hemoglobin a

SCOPe Domain Sequences for d2w72c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w72c_ a.1.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOPe Domain Coordinates for d2w72c_:

Click to download the PDB-style file with coordinates for d2w72c_.
(The format of our PDB-style files is described here.)

Timeline for d2w72c_: