![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries) |
![]() | Domain d2w6xa_: 2w6x A: [169082] automated match to d1dxca_ complexed with hem, so4, xe; mutant |
PDB Entry: 2w6x (more details), 1.73 Å
SCOPe Domain Sequences for d2w6xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w6xa_ a.1.1.2 (A:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]} mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikyleffseaiihvlhsrh pgdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d2w6xa_: