SCOPe 2.05: Domain d2w5ma_: 2w5m A:

Lineage for d2w5ma_ (2w5m A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (70 PDB entries)

8. Domain d2w5ma_: 2w5m A: [169072]
   automated match to d1a2wa_
   protein/RNA complex; complexed with pop

Details for d2w5ma_

PDB Entry: 2w5m, 1.8 Å

PDB Description: rnase a-pyrophosphate ion complex

PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2w5ma_:

Sequence; same for both SEQRES and ATOM records:

>d2w5ma_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d2w5ma_:

• d2w5ma_ first appeared in SCOPe 2.01
  
• d2w5ma_ appears in SCOPe 2.04
  
• d2w5ma_ appears in SCOPe 2.06
  
• d2w5ma_ appears in the current release, SCOPe 2.08