Lineage for d2w5la_ (2w5l A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1015692Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1015693Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1015694Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1015999Protein automated matches [190061] (4 species)
    not a true protein
  7. 1016000Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries)
  8. 1016049Domain d2w5la_: 2w5l A: [169070]
    automated match to d1a2wa_
    protein/RNA complex; complexed with nap

Details for d2w5la_

PDB Entry: 2w5l (more details), 1.7 Å

PDB Description: rnase a-nadp complex
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2w5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w5la_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d2w5la_:

Click to download the PDB-style file with coordinates for d2w5la_.
(The format of our PDB-style files is described here.)

Timeline for d2w5la_: