SCOPe 2.07: Domain d2w5kb_: 2w5k B:

Lineage for d2w5kb_ (2w5k B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)

8. Domain d2w5kb_: 2w5k B: [169069]
   automated match to d1a2wa_
   protein/RNA complex; complexed with ndp

Details for d2w5kb_

PDB Entry: 2w5k, 1.7 Å

PDB Description: rnase a-nadph complex

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d2w5kb_:

Sequence; same for both SEQRES and ATOM records:

>d2w5kb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d2w5kb_:

• d2w5kb_ first appeared in SCOPe 2.01
  
• d2w5kb_ appears in SCOPe 2.06
  
• d2w5kb_ appears in the current release, SCOPe 2.08