![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein automated matches [190061] (7 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries) |
![]() | Domain d2w5ib_: 2w5i B: [169067] automated match to d1a2wa_ protein/RNA complex; complexed with atp |
PDB Entry: 2w5i (more details), 2.4 Å
SCOPe Domain Sequences for d2w5ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w5ib_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf dasv
Timeline for d2w5ib_: