SCOPe 2.05: Domain d2w4ka_: 2w4k A:

Lineage for d2w4ka_ (2w4k A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)

8. Domain d2w4ka_: 2w4k A: [169059]
   automated match to d1ig1a_
   complexed with adp, mg

Details for d2w4ka_

PDB Entry: 2w4k, 1.9 Å

PDB Description: X-ray structure of a DAP-Kinase 2-302

PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d2w4ka_:

Sequence; same for both SEQRES and ATOM records:

>d2w4ka_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfaa
r

Timeline for d2w4ka_:

• d2w4ka_ first appeared in SCOPe 2.01
  
• d2w4ka_ appears in SCOPe 2.04
  
• d2w4ka_ appears in SCOPe 2.06
  
• d2w4ka_ appears in the current release, SCOPe 2.08