Lineage for d2w4fa_ (2w4f A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2379973Protein automated matches [190055] (6 species)
    not a true protein
  7. 2379982Species Human (Homo sapiens) [TaxId:9606] [187785] (44 PDB entries)
  8. 2379986Domain d2w4fa_: 2w4f A: [169058]
    automated match to d1x5qa1
    complexed with edo

Details for d2w4fa_

PDB Entry: 2w4f (more details), 1.3 Å

PDB Description: crystal structure of the first pdz domain of human scrib1
PDB Compounds: (A:) protein lap4

SCOPe Domain Sequences for d2w4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w4fa_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvgdkllevn
gvalqgaehheavealrgagtavqmrvwreretsv

SCOPe Domain Coordinates for d2w4fa_:

Click to download the PDB-style file with coordinates for d2w4fa_.
(The format of our PDB-style files is described here.)

Timeline for d2w4fa_: