SCOPe 2.01: Domain d2w4df_: 2w4d F:

Lineage for d2w4df_ (2w4d F:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)

6. Protein automated matches [191024] (2 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [189171] (1 PDB entry)

8. Domain d2w4df_: 2w4d F: [169057]
   automated match to d1v3za_
   complexed with k, po4

Details for d2w4df_

PDB Entry: 2w4d, 2.4 Å

PDB Description: acylphosphatase variant g91a from pyrococcus horikoshii

PDB Compounds: (F:) acylphosphatase

SCOPe Domain Sequences for d2w4df_:

Sequence; same for both SEQRES and ATOM records:

>d2w4df_ d.58.10.1 (F:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfriva

Timeline for d2w4df_:

• d2w4df_ is new in SCOPe 2.01-stable
  
• d2w4df_ appears in SCOPe 2.02
  
• d2w4df_ appears in the current release, SCOPe 2.08