Lineage for d2w4db_ (2w4d B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953324Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2953344Protein automated matches [191024] (3 species)
    not a true protein
  7. 2953354Species Pyrococcus horikoshii [TaxId:53953] [189171] (1 PDB entry)
  8. 2953356Domain d2w4db_: 2w4d B: [169053]
    automated match to d1v3za_
    complexed with k, po4

Details for d2w4db_

PDB Entry: 2w4d (more details), 2.4 Å

PDB Description: acylphosphatase variant g91a from pyrococcus horikoshii
PDB Compounds: (B:) acylphosphatase

SCOPe Domain Sequences for d2w4db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w4db_ d.58.10.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfriva

SCOPe Domain Coordinates for d2w4db_:

Click to download the PDB-style file with coordinates for d2w4db_.
(The format of our PDB-style files is described here.)

Timeline for d2w4db_: