![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
![]() | Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
![]() | Protein automated matches [191024] (3 species) not a true protein |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [189171] (1 PDB entry) |
![]() | Domain d2w4da_: 2w4d A: [169052] automated match to d1v3za_ complexed with k, po4 |
PDB Entry: 2w4d (more details), 2.4 Å
SCOPe Domain Sequences for d2w4da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w4da_ d.58.10.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw ahqgpplarvtrvevkweqpkgekgfriva
Timeline for d2w4da_: