Lineage for d2w4ca_ (2w4c A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560188Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2560189Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2560209Protein automated matches [191024] (3 species)
    not a true protein
  7. 2560210Species Human (Homo sapiens) [TaxId:9606] [188822] (6 PDB entries)
  8. 2560212Domain d2w4ca_: 2w4c A: [169051]
    automated match to d2acya_

Details for d2w4ca_

PDB Entry: 2w4c (more details), 1.52 Å

PDB Description: Human common-type acylphosphatase variant, A99
PDB Compounds: (A:) acylphosphatase-1

SCOPe Domain Sequences for d2w4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w4ca_ d.58.10.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgqlqgpiskvrhmqe
wletrgspkshidkanfnnekvilkldysdfqiva

SCOPe Domain Coordinates for d2w4ca_:

Click to download the PDB-style file with coordinates for d2w4ca_.
(The format of our PDB-style files is described here.)

Timeline for d2w4ca_: