Lineage for d1rfba_ (1rfb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2319033Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2319071Protein Interferon-gamma [47318] (3 species)
    intertwined dimer
  7. 2319072Species Cow (Bos taurus) [TaxId:9913] [47319] (3 PDB entries)
  8. 2319077Domain d1rfba_: 1rfb A: [16905]

Details for d1rfba_

PDB Entry: 1rfb (more details), 3 Å

PDB Description: crystal structure of recombinant bovine interferon-gamma at 3.0 angstroms resolution
PDB Compounds: (A:) interferon-gamma

SCOPe Domain Sequences for d1rfba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfba_ a.26.1.3 (A:) Interferon-gamma {Cow (Bos taurus) [TaxId: 9913]}
qgqffreienlkeyfnasspdvakggplfseilknwkdesdkkiiqsqivsfyfklfenl
kdnqviqrsmdiikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmnd

SCOPe Domain Coordinates for d1rfba_:

Click to download the PDB-style file with coordinates for d1rfba_.
(The format of our PDB-style files is described here.)

Timeline for d1rfba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rfbb_