Lineage for d2w43a_ (2w43 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (52 species)
    not a true protein
  7. 2491894Species Sulfolobus tokodaii [TaxId:111955] [188720] (2 PDB entries)
  8. 2491895Domain d2w43a_: 2w43 A: [169049]
    automated match to d1juda_
    complexed with mes, po4

Details for d2w43a_

PDB Entry: 2w43 (more details), 1.66 Å

PDB Description: structure of l-haloacid dehalogenase from s. tokodaii
PDB Compounds: (A:) hypothetical 2-haloalkanoic acid dehalogenase

SCOPe Domain Sequences for d2w43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w43a_ c.108.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
miilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvrgee
skfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkgifs
aesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivdpig
gkpdvivndfkelyewilryk

SCOPe Domain Coordinates for d2w43a_:

Click to download the PDB-style file with coordinates for d2w43a_.
(The format of our PDB-style files is described here.)

Timeline for d2w43a_: