Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188722] (88 PDB entries) |
Domain d2w3lb_: 2w3l B: [169044] automated match to d1gjha_ complexed with dro |
PDB Entry: 2w3l (more details), 2.1 Å
SCOPe Domain Sequences for d2w3lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3lb_ f.1.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ydnreivmkyihyklsqrgyewdagadsevvhktlreagddfsrryrrdfaemssglhlt pftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteyln rhlhtwiqdnggwdafvelygp
Timeline for d2w3lb_: