SCOPe 2.05: Domain d1d9cb_: 1d9c B:

Lineage for d1d9cb_ (1d9c B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Cow (Bos taurus) [TaxId:9913] [47319] (3 PDB entries)

8. Domain d1d9cb_: 1d9c B: [16902]

Details for d1d9cb_

PDB Entry: 1d9c, 2 Å

PDB Description: bovine interferon-gamma at 2.0 angstroms

PDB Compounds: (B:) interferon-gamma

SCOPe Domain Sequences for d1d9cb_:

Sequence; same for both SEQRES and ATOM records:

>d1d9cb_ a.26.1.3 (B:) Interferon-gamma {Cow (Bos taurus) [TaxId: 9913]}
qffreienlkeyfnasspdvakggplfseilknwkdesdkkiiqsqivsfyfklfenlkd
nqviqrsmdiikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmndls

Timeline for d1d9cb_:

• d1d9cb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d9cb_ appears in SCOPe 2.04
  
• d1d9cb_ appears in SCOPe 2.06
  
• d1d9cb_ appears in the current release, SCOPe 2.08