Lineage for d2w2cb_ (2w2c B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405495Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
    automatically mapped to Pfam PF13474
    automatically mapped to Pfam PF08332
  6. 1405516Protein automated matches [190404] (1 species)
    not a true protein
  7. 1405517Species Human (Homo sapiens) [TaxId:9606] [187282] (2 PDB entries)
  8. 1405524Domain d2w2cb_: 2w2c B: [169015]
    automated match to d1hkxa_
    complexed with act, cd

Details for d2w2cb_

PDB Entry: 2w2c (more details), 2.7 Å

PDB Description: structure of the tetradecameric oligomerisation domain of calcium- calmodulin dependent protein kinase ii delta
PDB Compounds: (B:) Calcium/calmodulin-dependent protein kinase type II delta chain

SCOPe Domain Sequences for d2w2cb_:

Sequence, based on SEQRES records: (download)

>d2w2cb_ d.17.4.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dedvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyf
enalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrd
gkwqnvhfhrsg

Sequence, based on observed residues (ATOM records): (download)

>d2w2cb_ d.17.4.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dedvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyf
enalkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwq
nvhfhrsg

SCOPe Domain Coordinates for d2w2cb_:

Click to download the PDB-style file with coordinates for d2w2cb_.
(The format of our PDB-style files is described here.)

Timeline for d2w2cb_: