SCOPe 2.08: Domain d2w22a_: 2w22 A:

Lineage for d2w22a_ (2w22 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein automated matches [190277] (12 species)
   not a true protein

7. Species Geobacillus thermocatenulatus [TaxId:33938] [188721] (2 PDB entries)

8. Domain d2w22a_: 2w22 A: [169011]
   automated match to d1ji3a_
   complexed with ca, egc, mpd, zn

Details for d2w22a_

PDB Entry: 2w22, 2.2 Å

PDB Description: activation mechanism of bacterial thermoalkalophilic lipases

PDB Compounds: (A:) triacylglycerol lipase

SCOPe Domain Sequences for d2w22a_:

Sequence; same for both SEQRES and ATOM records:

>d2w22a_ c.69.1.18 (A:) automated matches {Geobacillus thermocatenulatus [TaxId: 33938]}
asprandapivllhgftgwgreemlgfkywggvrgdieqwlndngyrtytlavgplssnw
draceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrvhiiahsqggqtar
mlvsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrf
fdlqkavlkaaavasnvpytsqvydfkldqwglrrqpgesfdhyferlkrspvwtstdta
rydlsipgaeklnqwvqaspntyylsfsterthrgaltgnyypelgmnafsavvcapflg
syrnealgiddrwlendgivntvsmngpkrgssdrivpydgtlkkgvwndmgtynvdhle
vigvdpnpsfdirafylrlaeqlaslrp

Timeline for d2w22a_:

• d2w22a_ first appeared in SCOPe 2.01
  
• d2w22a_ appears in SCOPe 2.07