Lineage for d2w21a_ (2w21 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138062Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2138063Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2138216Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2138217Protein automated matches [190728] (15 species)
    not a true protein
  7. 2138243Species Escherichia coli [TaxId:511693] [189123] (1 PDB entry)
  8. 2138244Domain d2w21a_: 2w21 A: [169010]
    automated match to d2akoa1
    complexed with so4

Details for d2w21a_

PDB Entry: 2w21 (more details), 2.95 Å

PDB Description: crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli.
PDB Compounds: (A:) Glutamate 5-kinase

SCOPe Domain Sequences for d2w21a_:

Sequence, based on SEQRES records: (download)

>d2w21a_ c.73.1.0 (A:) automated matches {Escherichia coli [TaxId: 511693]}
dsqtlvvklgtsvltggsrrlnrahivelvrqcaqlhaaghrivivtsgaiaagrehlgy
pelpatiaskqllaavgqsrliqlweqlfsiygihvgqmlltradmedrerflnardtlr
alldnnvvpvinendavataeikvgdndnlsalaailagadklllltdqkglytadprsn
pqaelikdvygiddalraiagdsvsglgtggmstklqaadvacragidtiiaagskpgvi
gdvmegisvgtlfhaq

Sequence, based on observed residues (ATOM records): (download)

>d2w21a_ c.73.1.0 (A:) automated matches {Escherichia coli [TaxId: 511693]}
dsqtlvvklgtsvltggsrrlnrahivelvrqcaqlhaaghrivivtsgaiaagrehlgy
pelpatiaskqllaavgqsrliqlweqlfsiygihvgqmlltradmedrerflnardtlr
alldnnvvpvinendavataikvgdndnlsalaailagadklllltdqkglytadprsnp
qaelikdvygiddalraiaggmstklqaadvacragidtiiaagskpgvigdvmegisvg
tlfhaq

SCOPe Domain Coordinates for d2w21a_:

Click to download the PDB-style file with coordinates for d2w21a_.
(The format of our PDB-style files is described here.)

Timeline for d2w21a_: