Lineage for d1d9ca_ (1d9c A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1993080Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 1993118Protein Interferon-gamma [47318] (3 species)
    intertwined dimer
  7. 1993119Species Cow (Bos taurus) [TaxId:9913] [47319] (3 PDB entries)
  8. 1993120Domain d1d9ca_: 1d9c A: [16901]

Details for d1d9ca_

PDB Entry: 1d9c (more details), 2 Å

PDB Description: bovine interferon-gamma at 2.0 angstroms
PDB Compounds: (A:) interferon-gamma

SCOPe Domain Sequences for d1d9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9ca_ a.26.1.3 (A:) Interferon-gamma {Cow (Bos taurus) [TaxId: 9913]}
qgqffreienlkeyfnasspdvakggplfseilknwkdesdkkiiqsqivsfyfklfenl
kdnqviqrsmdiikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmndl
s

SCOPe Domain Coordinates for d1d9ca_:

Click to download the PDB-style file with coordinates for d1d9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1d9ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d9cb_