![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
![]() | Domain d2w1ga1: 2w1g A:127-389 [169008] Other proteins in same PDB: d2w1ga2 automated match to d1ol5a_ complexed with l0g |
PDB Entry: 2w1g (more details), 2.71 Å
SCOPe Domain Sequences for d2w1ga1:
Sequence, based on SEQRES records: (download)
>d2w1ga1 d.144.1.7 (A:127-389) automated matches {Human (Homo sapiens) [TaxId: 9606]} qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy chskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmh dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh npsqrpmlrevlehpwitanssk
>d2w1ga1 d.144.1.7 (A:127-389) automated matches {Human (Homo sapiens) [TaxId: 9606]} qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy chskrvihrdikpenlllgsagelkiadfgwsvhagtldylppemiegrmhdekvdlwsl gvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlr evlehpwitanssk
Timeline for d2w1ga1: