Lineage for d2w1ga1 (2w1g A:127-389)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (741 PDB entries)
  8. 2545807Domain d2w1ga1: 2w1g A:127-389 [169008]
    Other proteins in same PDB: d2w1ga2
    automated match to d1ol5a_
    complexed with l0g

Details for d2w1ga1

PDB Entry: 2w1g (more details), 2.71 Å

PDB Description: structure determination of aurora kinase in complex with inhibitor
PDB Compounds: (A:) serine/threonine-protein kinase 6

SCOPe Domain Sequences for d2w1ga1:

Sequence, based on SEQRES records: (download)

>d2w1ga1 d.144.1.7 (A:127-389) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
chskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmh
dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
npsqrpmlrevlehpwitanssk

Sequence, based on observed residues (ATOM records): (download)

>d2w1ga1 d.144.1.7 (A:127-389) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
chskrvihrdikpenlllgsagelkiadfgwsvhagtldylppemiegrmhdekvdlwsl
gvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlr
evlehpwitanssk

SCOPe Domain Coordinates for d2w1ga1:

Click to download the PDB-style file with coordinates for d2w1ga1.
(The format of our PDB-style files is described here.)

Timeline for d2w1ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w1ga2