Lineage for d2w1aa_ (2w1a A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086424Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2086439Protein automated matches [191084] (3 species)
    not a true protein
  7. 2086444Species Mycobacterium tuberculosis [TaxId:83332] [189029] (7 PDB entries)
  8. 2086452Domain d2w1aa_: 2w1a A: [169003]
    automated match to d2b7oa1
    complexed with ce1, gol, mn, pg4, so4, tsa

Details for d2w1aa_

PDB Entry: 2w1a (more details), 2.35 Å

PDB Description: Non-covalent complex between dahp synthase and chorismate mutase from Mycobacterium tuberculosis with bound tsa
PDB Compounds: (A:) 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase arog

SCOPe Domain Sequences for d2w1aa_:

Sequence, based on SEQRES records: (download)

>d2w1aa_ c.1.10.8 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
wtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvps
eivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvv
kvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnl
vraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqtae
iyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvianp
vgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqvi
wqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvteclg
gaqdisetdlagryetacdprlntqqslelaflvaemlrd

Sequence, based on observed residues (ATOM records): (download)

>d2w1aa_ c.1.10.8 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
wtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvps
eivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvv
kvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnl
vraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvaeiyashea
lvldyeramlrlsddgepqlfdlsahtvwigertrqidgahiafaqvianpvgvklgpnm
tpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqviwqcdpmhgn
thesstgfktrhfdrivdevqgffevhralgthpggihveitgenvteclggaqdisetd
lagryetacdprlntqqslelaflvaemlrd

SCOPe Domain Coordinates for d2w1aa_:

Click to download the PDB-style file with coordinates for d2w1aa_.
(The format of our PDB-style files is described here.)

Timeline for d2w1aa_: