SCOPe 2.07: Domain d1b5la_: 1b5l A:

Lineage for d1b5la_ (1b5l A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-tau [47316] (1 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [47317] (1 PDB entry)

8. Domain d1b5la_: 1b5l A: [16900]
   complexed with so4

Details for d1b5la_

PDB Entry: 1b5l, 2.1 Å

PDB Description: ovine interferon tau

PDB Compounds: (A:) interferon tau

SCOPe Domain Sequences for d1b5la_:

Sequence, based on SEQRES records:

>d1b5la_ a.26.1.3 (A:) Interferon-tau {Sheep (Ovis aries) [TaxId: 9940]}
cylsrklmldarenlklldrmnrlsphsclqdrkdfglpqemvegdqlqkdqafpvlyem
lqqsfnlfytehssaawdttlleqlctglqqqldhldtcrgqvmgeedselgnmdpivtv
kkyfqgiydylqekgysdcaweivrvemmraltvsttlqkrltk

Sequence, based on observed residues (ATOM records):

>d1b5la_ a.26.1.3 (A:) Interferon-tau {Sheep (Ovis aries) [TaxId: 9940]}
cylsrklmldarenlklldrmnrlsphsclqdrkdfglpqemvegdqlqkdqafpvlyem
lqqsfnlfytehssaawdttlleqlctglqqqldhldtcrgmdpivtvkkyfqgiydylq
ekgysdcaweivrvemmraltvsttlqkrltk

Timeline for d1b5la_:

• d1b5la_ first appeared (with stable ids) in SCOP 1.55, called d1b5l__
  
• d1b5la_ appears in SCOPe 2.06
  
• d1b5la_ appears in the current release, SCOPe 2.08