Lineage for d2w0ub_ (2w0u B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080558Species Human (Homo sapiens) [TaxId:9606] [189110] (5 PDB entries)
  8. 2080564Domain d2w0ub_: 2w0u B: [168988]
    automated match to d1al7a_
    complexed with c7c, fmn

Details for d2w0ub_

PDB Entry: 2w0u (more details), 2.84 Å

PDB Description: crystal structure of human glycolate oxidase in complex with the inhibitor 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate.
PDB Compounds: (B:) hydroxyacid oxidase 1

SCOPe Domain Sequences for d2w0ub_:

Sequence, based on SEQRES records: (download)

>d2w0ub_ c.1.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
licindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdlst
svlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagpe
alrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppqlrmk
nfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilrgdda
reavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdvlkal
algakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlvrkn

Sequence, based on observed residues (ATOM records): (download)

>d2w0ub_ c.1.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
licindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdlst
svlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagpe
alrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklglaayva
kaidpsiswedikwlrrltslpivakgilrgddareavkhglngilvsnhgarqldgvpa
tidvlpeiveavegkvevfldggvrkgtdvlkalalgakavfvgrpivwglafqgekgvq
dvleilkeefrlamalsgcqnvkvidktlvrkn

SCOPe Domain Coordinates for d2w0ub_:

Click to download the PDB-style file with coordinates for d2w0ub_.
(The format of our PDB-style files is described here.)

Timeline for d2w0ub_: