Lineage for d2w0sa_ (2w0s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873146Species Vaccinia virus copenhagen [TaxId:10249] [188639] (2 PDB entries)
  8. 2873149Domain d2w0sa_: 2w0s A: [168985]
    automated match to d1e98a_
    complexed with bvp, mg, so4

Details for d2w0sa_

PDB Entry: 2w0s (more details), 2.92 Å

PDB Description: Crystal structure of vaccinia virus thymidylate kinase bound to brivudin-5'-monophosphate
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d2w0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0sa_ c.37.1.0 (A:) automated matches {Vaccinia virus copenhagen [TaxId: 10249]}
srgalivfegldksgkttqcmnimesipantikylnfpqrstvtgkmiddyltrkktynd
hivnllfcanrwefasfiqeqleqgitlivdryafsgvayaaakgasmtlsksyesglpk
pdlviflesgskeinrnvgeeiyedvtfqqkvlqeykkmieegdihwqiissefeedvkk
eliknivieaihtvtgpvgqlwm

SCOPe Domain Coordinates for d2w0sa_:

Click to download the PDB-style file with coordinates for d2w0sa_.
(The format of our PDB-style files is described here.)

Timeline for d2w0sa_: