SCOPe 2.08: Domain d2w0sa_: 2w0s A:

Lineage for d2w0sa_ (2w0s A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Vaccinia virus copenhagen [TaxId:10249] [188639] (2 PDB entries)

8. Domain d2w0sa_: 2w0s A: [168985]
   automated match to d1e98a_
   complexed with bvp, mg, so4

Details for d2w0sa_

PDB Entry: 2w0s, 2.92 Å

PDB Description: Crystal structure of vaccinia virus thymidylate kinase bound to brivudin-5'-monophosphate

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d2w0sa_:

Sequence; same for both SEQRES and ATOM records:

>d2w0sa_ c.37.1.0 (A:) automated matches {Vaccinia virus copenhagen [TaxId: 10249]}
srgalivfegldksgkttqcmnimesipantikylnfpqrstvtgkmiddyltrkktynd
hivnllfcanrwefasfiqeqleqgitlivdryafsgvayaaakgasmtlsksyesglpk
pdlviflesgskeinrnvgeeiyedvtfqqkvlqeykkmieegdihwqiissefeedvkk
eliknivieaihtvtgpvgqlwm

Timeline for d2w0sa_:

• d2w0sa_ first appeared in SCOPe 2.01
  
• d2w0sa_ appears in SCOPe 2.07