Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
Domain d2w0kb1: 2w0k B:1-98 [168983] Other proteins in same PDB: d2w0ka2, d2w0kb2 automated match to d1cd0a_ |
PDB Entry: 2w0k (more details), 2.35 Å
SCOPe Domain Sequences for d2w0kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w0kb1 b.1.1.1 (B:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]} nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp drfsgsidsssnsasltisglktedeadyycqsydssn
Timeline for d2w0kb1: