SCOPe 2.05: Domain d1rh2f_: 1rh2 F:

Lineage for d1rh2f_ (1rh2 F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-alpha 2b [47312] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47313] (1 PDB entry)

8. Domain d1rh2f_: 1rh2 F: [16898]
   CA-atoms only
   complexed with zn

Details for d1rh2f_

PDB Entry: 1rh2, 2.9 Å

PDB Description: recombinant human interferon-alpha 2b

PDB Compounds: (F:) interferon-alpha 2b

SCOPe Domain Sequences for d1rh2f_:

Sequence, based on SEQRES records:

>d1rh2f_ a.26.1.3 (F:) Interferon-alpha 2b {Human (Homo sapiens) [TaxId: 9606]}
gsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfst
kdssaawdetlldkfytelyqqlndleacviqgvgvtetplmnedsilavrkyfqritly
lkekkyspcawevvraeimrsfslstn

Sequence, based on observed residues (ATOM records):

>d1rh2f_ a.26.1.3 (F:) Interferon-alpha 2b {Human (Homo sapiens) [TaxId: 9606]}
gsrrtlmllaqmrrislfsclkdrhdfgfpqeeftipvlhemiqqifnlfstkdssaawd
etlldkfytelyqqlnedsilavrkyfqritlylkekkyspcawevvraeimrsfslstn

Timeline for d1rh2f_:

• d1rh2f_ first appeared (with stable ids) in SCOP 1.55
  
• d1rh2f_ appears in SCOPe 2.04
  
• d1rh2f_ appears in SCOPe 2.06
  
• d1rh2f_ appears in the current release, SCOPe 2.08