Lineage for d2w0dc1 (2w0d C:106-263)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964641Protein automated matches [190182] (1 species)
    not a true protein
  7. 2964642Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2964675Domain d2w0dc1: 2w0d C:106-263 [168979]
    Other proteins in same PDB: d2w0da2, d2w0db2, d2w0dc2, d2w0dc3, d2w0dd2, d2w0dd3
    automated match to d1jk3a_
    complexed with act, ca, cgs, cl, na, zn

Details for d2w0dc1

PDB Entry: 2w0d (more details), 2 Å

PDB Description: does a fast nuclear magnetic resonance spectroscopy- and x-ray crystallography hybrid approach provide reliable structural information of ligand-protein complexes? a case study of metalloproteinases.
PDB Compounds: (C:) Macrophage metalloelastase

SCOPe Domain Sequences for d2w0dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0dc1 d.92.1.11 (C:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d2w0dc1:

Click to download the PDB-style file with coordinates for d2w0dc1.
(The format of our PDB-style files is described here.)

Timeline for d2w0dc1: