SCOPe 2.08: Domain d2w0db1: 2w0d B:106-263

Lineage for d2w0db1 (2w0d B:106-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)

8. Domain d2w0db1: 2w0d B:106-263 [168978]
   Other proteins in same PDB: d2w0da2, d2w0db2, d2w0dc2, d2w0dc3, d2w0dd2, d2w0dd3
   automated match to d1jk3a_
   complexed with act, ca, cgs, cl, na, zn

Details for d2w0db1

PDB Entry: 2w0d, 2 Å

PDB Description: does a fast nuclear magnetic resonance spectroscopy- and x-ray crystallography hybrid approach provide reliable structural information of ligand-protein complexes? a case study of metalloproteinases.

PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d2w0db1:

Sequence; same for both SEQRES and ATOM records:

>d2w0db1 d.92.1.11 (B:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d2w0db1:

• d2w0db1 first appeared in SCOPe 2.01, called d2w0db_
  
• d2w0db1 appears in SCOPe 2.07