Lineage for d2w08a_ (2w08 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389323Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 2389411Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 2389412Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. 2389418Domain d2w08a_: 2w08 A: [168969]
    automated match to d1gyka_
    complexed with ca, nag, tpo

Details for d2w08a_

PDB Entry: 2w08 (more details), 1.7 Å

PDB Description: the structure of serum amyloid p component bound to 0-phospho- threonine
PDB Compounds: (A:) serum amyloid p-component

SCOPe Domain Sequences for d2w08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w08a_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d2w08a_:

Click to download the PDB-style file with coordinates for d2w08a_.
(The format of our PDB-style files is described here.)

Timeline for d2w08a_: