Lineage for d2vzxe_ (2vzx E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899146Protein automated matches [190406] (16 species)
    not a true protein
  7. 1899284Species Dendronephthya sp. [TaxId:191210] [188919] (1 PDB entry)
  8. 1899289Domain d2vzxe_: 2vzx E: [168963]
    automated match to d1mova_
    complexed with gol, pg4

Details for d2vzxe_

PDB Entry: 2vzx (more details), 2 Å

PDB Description: structural and spectroscopic characterization of photoconverting fluorescent protein dendra2
PDB Compounds: (E:) Green fluorescent protein

SCOPe Domain Sequences for d2vzxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzxe_ d.22.1.1 (E:) automated matches {Dendronephthya sp. [TaxId: 191210]}
likedmrvkvhmegnvnghafviegegkgkpyegtqtanltvkegaplpfsydilttavh
ygnrvftkypedipdyfkqsfpegyswertmtfedkgictirsdislegdcffqnvrfkg
tnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkv
vqlpdahfvdhrieilgndsdynkvklyehavarysplpsqvwhh

SCOPe Domain Coordinates for d2vzxe_:

Click to download the PDB-style file with coordinates for d2vzxe_.
(The format of our PDB-style files is described here.)

Timeline for d2vzxe_: