Lineage for d2vzxd_ (2vzx D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1021950Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1022143Protein automated matches [190406] (14 species)
    not a true protein
  7. 1022232Species Dendronephthya sp. [TaxId:191210] [188919] (1 PDB entry)
  8. 1022236Domain d2vzxd_: 2vzx D: [168962]
    automated match to d1mova_
    complexed with gol, pg4

Details for d2vzxd_

PDB Entry: 2vzx (more details), 2 Å

PDB Description: structural and spectroscopic characterization of photoconverting fluorescent protein dendra2
PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d2vzxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzxd_ d.22.1.1 (D:) automated matches {Dendronephthya sp. [TaxId: 191210]}
nlikedmrvkvhmegnvnghafviegegkgkpyegtqtanltvkegaplpfsydilttav
hygnrvftkypedipdyfkqsfpegyswertmtfedkgictirsdislegdcffqnvrfk
gtnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk
vvqlpdahfvdhrieilgndsdynkvklyehavarysplpsqvw

SCOPe Domain Coordinates for d2vzxd_:

Click to download the PDB-style file with coordinates for d2vzxd_.
(The format of our PDB-style files is described here.)

Timeline for d2vzxd_: