![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (14 species) not a true protein |
![]() | Species Dendronephthya sp. [TaxId:191210] [188919] (1 PDB entry) |
![]() | Domain d2vzxd_: 2vzx D: [168962] automated match to d1mova_ complexed with gol, pg4 |
PDB Entry: 2vzx (more details), 2 Å
SCOPe Domain Sequences for d2vzxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzxd_ d.22.1.1 (D:) automated matches {Dendronephthya sp. [TaxId: 191210]} nlikedmrvkvhmegnvnghafviegegkgkpyegtqtanltvkegaplpfsydilttav hygnrvftkypedipdyfkqsfpegyswertmtfedkgictirsdislegdcffqnvrfk gtnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakk vvqlpdahfvdhrieilgndsdynkvklyehavarysplpsqvw
Timeline for d2vzxd_: