Class a: All alpha proteins [46456] (289 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) |
Family a.6.1.0: automated matches [191604] (1 protein) not a true family |
Protein automated matches [191102] (6 species) not a true protein |
Species Streptomyces lividans [TaxId:1916] [189122] (1 PDB entry) |
Domain d2vz4a_: 2vz4 A: [168956] automated match to d1r8da_ |
PDB Entry: 2vz4 (more details), 2.9 Å
SCOPe Domain Sequences for d2vz4a_:
Sequence, based on SEQRES records: (download)
>d2vz4a_ a.6.1.0 (A:) automated matches {Streptomyces lividans [TaxId: 1916]} sysvgqvagfagvtvrtlhhyddigllvpsershaghrrysdadldrlqqilfyrelgfp ldevaallddpaadprahlrrqhellsarigklqkmaaaveqame
>d2vz4a_ a.6.1.0 (A:) automated matches {Streptomyces lividans [TaxId: 1916]} sysvgqvagfagvtvrtlhhyddigllvpsershaghrrysdadldrlqqilfyrelgfp ldevaallddrahlrrqhellsarigklqkmaaaveqame
Timeline for d2vz4a_: