Lineage for d2vz4a_ (2vz4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309714Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2309715Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2309833Family a.6.1.0: automated matches [191604] (1 protein)
    not a true family
  6. 2309834Protein automated matches [191102] (6 species)
    not a true protein
  7. 2309864Species Streptomyces lividans [TaxId:1916] [189122] (1 PDB entry)
  8. 2309865Domain d2vz4a_: 2vz4 A: [168956]
    automated match to d1r8da_

Details for d2vz4a_

PDB Entry: 2vz4 (more details), 2.9 Å

PDB Description: the n-terminal domain of merr-like protein tipal bound to promoter dna
PDB Compounds: (A:) hth-type transcriptional activator tipa

SCOPe Domain Sequences for d2vz4a_:

Sequence, based on SEQRES records: (download)

>d2vz4a_ a.6.1.0 (A:) automated matches {Streptomyces lividans [TaxId: 1916]}
sysvgqvagfagvtvrtlhhyddigllvpsershaghrrysdadldrlqqilfyrelgfp
ldevaallddpaadprahlrrqhellsarigklqkmaaaveqame

Sequence, based on observed residues (ATOM records): (download)

>d2vz4a_ a.6.1.0 (A:) automated matches {Streptomyces lividans [TaxId: 1916]}
sysvgqvagfagvtvrtlhhyddigllvpsershaghrrysdadldrlqqilfyrelgfp
ldevaallddrahlrrqhellsarigklqkmaaaveqame

SCOPe Domain Coordinates for d2vz4a_:

Click to download the PDB-style file with coordinates for d2vz4a_.
(The format of our PDB-style files is described here.)

Timeline for d2vz4a_: