SCOPe 2.01: Domain d2vyya_: 2vyy A:

Lineage for d2vyya_ (2vyy A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
   lack the first helix but otherwise is more similar to conventional globins than the truncated ones

6. Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)

7. Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (5 PDB entries)
   Uniprot O76242

8. Domain d2vyya_: 2vyy A: [168950]
   automated match to d1kr7a_
   complexed with gol, hem, oxy, so4; mutant

Details for d2vyya_

PDB Entry: 2vyy, 1.6 Å

PDB Description: mutant ala55trp of cerebratuls lacteus mini-hemoglobin

PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d2vyya_:

Sequence; same for both SEQRES and ATOM records:

>d2vyya_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinawiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl

Timeline for d2vyya_:

• d2vyya_ is new in SCOPe 2.01-stable
  
• d2vyya_ appears in SCOPe 2.02
  
• d2vyya_ appears in the current release, SCOPe 2.08