Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name |
Protein automated matches [190247] (4 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [187586] (6 PDB entries) |
Domain d2vyxl_: 2vyx L: [168949] automated match to d2cz8a1 complexed with cl, coa, fmn, na; mutant |
PDB Entry: 2vyx (more details), 1.5 Å
SCOPe Domain Sequences for d2vyxl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyxl_ d.230.2.1 (L:) automated matches {Thermus thermophilus [TaxId: 300852]} gkvykkvelvgtseegleaaiqaalararktlrhldffevkeirgtigeagvkeyqvvle vgfrle
Timeline for d2vyxl_: