Lineage for d2vyxc_ (2vyx C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008035Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 3008036Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
    automatically mapped to Pfam PF07311
  6. 3008046Protein automated matches [190247] (4 species)
    not a true protein
  7. 3008064Species Thermus thermophilus HB8 [TaxId:300852] [187586] (6 PDB entries)
  8. 3008074Domain d2vyxc_: 2vyx C: [168940]
    automated match to d2cz8a1
    complexed with cl, coa, fmn, na; mutant

Details for d2vyxc_

PDB Entry: 2vyx (more details), 1.5 Å

PDB Description: crystal structure of the t. thermophilus dodecin w38f mutant
PDB Compounds: (C:) ttha1431

SCOPe Domain Sequences for d2vyxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyxc_ d.230.2.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
gkvykkvelvgtseegleaaiqaalararktlrhldffevkeirgtigeagvkeyqvvle
vgfrleet

SCOPe Domain Coordinates for d2vyxc_:

Click to download the PDB-style file with coordinates for d2vyxc_.
(The format of our PDB-style files is described here.)

Timeline for d2vyxc_: