| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) ![]() |
| Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name automatically mapped to Pfam PF07311 |
| Protein automated matches [190247] (4 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [187586] (6 PDB entries) |
| Domain d2vyxc_: 2vyx C: [168940] automated match to d2cz8a1 complexed with cl, coa, fmn, na; mutant |
PDB Entry: 2vyx (more details), 1.5 Å
SCOPe Domain Sequences for d2vyxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyxc_ d.230.2.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
gkvykkvelvgtseegleaaiqaalararktlrhldffevkeirgtigeagvkeyqvvle
vgfrleet
Timeline for d2vyxc_: