SCOPe 2.01: Domain d2vywa_: 2vyw A:

Lineage for d2vywa_ (2vyw A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (10 species)
   not a true protein

7. Species Fasciola hepatica [TaxId:6192] [188561] (1 PDB entry)

8. Domain d2vywa_: 2vyw A: [168937]
   automated match to d1h97a_
   complexed with hem, oxy

Details for d2vywa_

PDB Entry: 2vyw, 1.8 Å

PDB Description: hemoglobin (hb2) from trematode fasciola hepatica

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d2vywa_:

Sequence; same for both SEQRES and ATOM records:

>d2vywa_ a.1.1.0 (A:) automated matches {Fasciola hepatica [TaxId: 6192]}
avltqtqidsiladlahhtdttehitemgvsiyktlfaahpeyisyfsklqgltkdnvgq
segiryygrtlgeelirllkaasnpsvleerivqgakdhkarpvtkdqftgaapifikff
qgllkkqedkdaiekfllhvmqaiaakm

Timeline for d2vywa_:

• d2vywa_ is new in SCOPe 2.01-stable
  
• d2vywa_ appears in SCOPe 2.02
  
• d2vywa_ appears in the current release, SCOPe 2.08