Lineage for d2vyrd_ (2vyr D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915347Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 915348Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 915385Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 915386Protein automated matches [190960] (1 species)
    not a true protein
  7. 915387Species Human (Homo sapiens) [TaxId:9606] [188578] (9 PDB entries)
  8. 915403Domain d2vyrd_: 2vyr D: [168936]
    automated match to d1ycqa_
    complexed with so4

Details for d2vyrd_

PDB Entry: 2vyr (more details), 2 Å

PDB Description: Structure of human MDM4 N-terminal domain bound to a single domain antibody
PDB Compounds: (D:) mdm4 protein

SCOPe Domain Sequences for d2vyrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyrd_ a.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
lgrqsfsvkdpsplydmlrknlvtla

SCOPe Domain Coordinates for d2vyrd_:

Click to download the PDB-style file with coordinates for d2vyrd_.
(The format of our PDB-style files is described here.)

Timeline for d2vyrd_: