Class a: All alpha proteins [46456] (286 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) binds to the transactivation domain of human p53 |
Family a.42.1.0: automated matches [191556] (1 protein) not a true family |
Protein automated matches [190960] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188578] (10 PDB entries) |
Domain d2vyra_: 2vyr A: [168933] Other proteins in same PDB: d2vyre_, d2vyrf_, d2vyrg_, d2vyrh_, d2vyri_, d2vyrj_, d2vyrk_, d2vyrl_ automated match to d1ycqa_ complexed with so4 |
PDB Entry: 2vyr (more details), 2 Å
SCOPe Domain Sequences for d2vyra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyra_ a.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel lgrqsfsvkdpsplydmlrknlvtla
Timeline for d2vyra_: