| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Synechococcus elongatus [TaxId:32046] [189121] (1 PDB entry) |
| Domain d2vxxd_: 2vxx D: [168932] automated match to d1moja_ complexed with fe, peg, pg4, zn |
PDB Entry: 2vxx (more details), 2.4 Å
SCOPe Domain Sequences for d2vxxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vxxd_ a.25.1.0 (D:) automated matches {Synechococcus elongatus [TaxId: 32046]}
alprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefyplhq
ffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsndlqa
eqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkv
Timeline for d2vxxd_: