Lineage for d2vxxc_ (2vxx C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085586Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1085587Protein automated matches [190036] (15 species)
    not a true protein
  7. 1085770Species Synechococcus elongatus [TaxId:32046] [189121] (1 PDB entry)
  8. 1085773Domain d2vxxc_: 2vxx C: [168931]
    automated match to d1moja_
    complexed with fe, peg, pg4, zn

Details for d2vxxc_

PDB Entry: 2vxx (more details), 2.4 Å

PDB Description: x-ray structure of dpsa from thermosynechococcus elongatus
PDB Compounds: (C:) starvation induced DNA binding protein

SCOPe Domain Sequences for d2vxxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxxc_ a.25.1.0 (C:) automated matches {Synechococcus elongatus [TaxId: 32046]}
salprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefyplh
qffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsndlq
aeqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkv

SCOPe Domain Coordinates for d2vxxc_:

Click to download the PDB-style file with coordinates for d2vxxc_.
(The format of our PDB-style files is described here.)

Timeline for d2vxxc_: