SCOPe 2.06: Domain d2vxxb_: 2vxx B:

Lineage for d2vxxb_ (2vxx B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:32046] [189121] (1 PDB entry)

8. Domain d2vxxb_: 2vxx B: [168930]
   automated match to d1moja_
   complexed with fe, peg, pg4, zn

Details for d2vxxb_

PDB Entry: 2vxx, 2.4 Å

PDB Description: x-ray structure of dpsa from thermosynechococcus elongatus

PDB Compounds: (B:) starvation induced DNA binding protein

SCOPe Domain Sequences for d2vxxb_:

Sequence; same for both SEQRES and ATOM records:

>d2vxxb_ a.25.1.0 (B:) automated matches {Synechococcus elongatus [TaxId: 32046]}
salprqafgemadtvillekatttpicegmnrllasfqalylqyqkhhfvvegaefyplh
qffqdcyeqvqdhvhalgerlnglggvpvagfqqlaalccftpepegafncrqmlsndlq
aeqaiigvlrqqatqaeslgdrataylydqillkteerayhighflandslkv

Timeline for d2vxxb_:

• d2vxxb_ first appeared in SCOPe 2.01
  
• d2vxxb_ appears in SCOPe 2.05
  
• d2vxxb_ appears in SCOPe 2.07
  
• d2vxxb_ appears in the current release, SCOPe 2.08